DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ssx and SRSF10

DIOPT Version :9

Sequence 1:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_473357.1 Gene:SRSF10 / 10772 HGNCID:16713 Length:262 Species:Homo sapiens


Alignment Length:210 Identity:47/210 - (22%)
Similarity:82/210 - (39%) Gaps:43/210 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 MQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSE 148
            |.:..|...|:|.:..:..|....:|...|...|||....:..||.|....|:.:|.::...|:|
Human     1 MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAE 65

  Fly   149 DAIQKLNGFYVRNKRLKVSYAR-----PGGQSIK------------DTNLYVINLSRNIN----- 191
            ||:..|:..::..:::::.:|:     |.....|            |.:.|..:.||:..     
Human    66 DALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSR 130

  Fly   192 ----DDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKR--EEAQEAIKALNNTVPEGGSQ 250
                |....|.:||      ||   .:.|||||.......|.|  ...:...::.:|:.....||
Human   131 SRSFDYNYRRSYSP------RN---SRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQ 186

  Fly   251 PIWVRLAEEHGKAKA 265
            |      ::..|||:
Human   187 P------KKEMKAKS 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 20/84 (24%)
RRM_SF 179..257 CDD:302621 20/88 (23%)
SRSF10NP_473357.1 RRM_SF 5..99 CDD:418427 21/93 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..262 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.