DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12773 and Slc12a2

DIOPT Version :10

Sequence 1:NP_569905.1 Gene:CG12773 / 31082 FlyBaseID:FBgn0024365 Length:712 Species:Drosophila melanogaster
Sequence 2:NP_033220.2 Gene:Slc12a2 / 20496 MGIID:101924 Length:1206 Species:Mus musculus


Alignment Length:175 Identity:32/175 - (18%)
Similarity:55/175 - (31%) Gaps:75/175 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 WSWAPN-CYYSSHVFEVSL-------------------YNVPLEELLKIRKVNILINGKVI---- 138
            |..:.| |.|....:|..|                   |:.|:.          ..:|:::    
Mouse    21 WIGSSNGCLYPGGDYEFKLKLDKNVIPALAGCAQIPCAYSAPMR----------THSGRLVWFSG 75

  Fly   139 --DLNIKQVMPKLKDGLTICVQPVYWYNQFQNIILFIESWRNQGASHFIVYFHSSTKEVKMVLDH 201
              |..|.....:.||||   ::|:....:..:|:|    |...|        |...:|..::|: 
Mouse    76 SPDFPISPRDMERKDGL---LRPLASILEECSIVL----WDFSG--------HERVEEYGVMLE- 124

  Fly   202 YQKLGILTIMPWPTFGTLPTQFPNINSQVY--RVGHNLAANLCVL 244
                       |.|..|          .||  ||..:.:|.:|.:
Mouse   125 -----------WGTNET----------HVYDERVAVSYSAGMCFI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12773NP_569905.1 AA_permease_2 88..>456 CDD:459263 32/175 (18%)
Slc12a2NP_033220.2 PRK07764 <3..74 CDD:236090 9/62 (15%)
RFXV motif 1. /evidence=ECO:0000269|PubMed:14563843 78..81 1/2 (50%)
RFXV motif 2. /evidence=ECO:0000269|PubMed:14563843 134..137 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..188 1/5 (20%)
2a30 210..1206 CDD:273347
Scissor helix. /evidence=ECO:0000250|UniProtKB:P55011 755..772
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 954..987
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.