DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and AT3G56320

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001327113.1 Gene:AT3G56320 / 824799 AraportID:AT3G56320 Length:603 Species:Arabidopsis thaliana


Alignment Length:487 Identity:88/487 - (18%)
Similarity:155/487 - (31%) Gaps:211/487 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 IPLEAAVPS---RLVYHTKENLSN-------GRSQTQRHMECFGDMLHLFLPGVCHVRRILQARV 299
            :||:..:|.   .|...||:|:.:       .|.|.:.....|......|:|          |:|
plant    89 VPLKTYLPDGDIDLTVLTKQNMDDDFYGQLCSRLQNEERESEFHATDVQFIP----------AQV 143

  Fly   300 PIIKYHHEHLDLEVDLSMSNLTGF----YMSELLYMFGEMDPRVRPLTFTIRRW---------AQ 351
            .:||.:..  ::.||:|.:...|.    ::.::..:||. |...:.....::.|         |.
plant   144 KVIKCNIR--NIAVDISFNQTAGLCALCFLEQVDQLFGR-DHLFKRSIILVKAWCYYESRILGAN 205

  Fly   352 TCGLTNPSPGRWISNFSLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVD 416
            | ||        ||.::|..||::.:...                                    
plant   206 T-GL--------ISTYALAVLVLYIINLF------------------------------------ 225

  Fly   417 RLGFRSRNQSSLS---ELLLQFFEFYSQFDFHNRAISLNEGKPLSK-PDHSA------------- 464
                    .||||   .:|.:|.::|..||::|..||:|...|:|. |:.:|             
plant   226 --------HSSLSGPLAVLYKFLDYYGSFDWNNYCISVNGPVPISSLPELTAASPENGHELLLDE 282

  Fly   465 ----------------------------MYIVNPLEQLLNVSKNVSLEECERLR-------IEVR 494
                                        :.||:||:...|:.|:|:....:|:|       .::|
plant   283 KFLRNCVELYSAPTKAVDSNGLEFPIKHLNIVDPLKYSNNLGKSVTQGNVQRIRHAFTLGARKLR 347

  Fly   495 NA--------AWVLESEVENASVPEGDGQELSCGLLNLFKHPEKAVIRPNMFFKPRMVEVSDL-- 549
            :.        .|.||....|:....|.||             .:.|..|...|.....|:|:|  
plant   348 DVLSLPGDTMGWRLEKFFRNSLERNGKGQ-------------RQDVNDPVTAFGTGRSELSELSG 399

  Fly   550 ----------FEQKEAGATSSSTPPT------PA-------------ITYKSASVRQQVQSIKAA 585
                      :.|...|   .|.|.|      |.             :||:....  .::|:..:
plant   400 DFDSSFGRLVYGQMYHG---HSLPGTFQHGYIPVSSHLSGWDIVRHLVTYRKNEF--HLRSLNVS 459

  Fly   586 TRSE-------------LKQLRGSGSSVPTSS 604
            |..:             :::.||:|:.:|..|
plant   460 TSMQPFPLHSLPNGCQNMRKTRGTGTYIPDMS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 20/101 (20%)
PAP_assoc 427..477 CDD:281779 20/94 (21%)
AT3G56320NP_001327113.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.