DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and AT2G45620

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_566048.1 Gene:AT2G45620 / 819170 AraportID:AT2G45620 Length:764 Species:Arabidopsis thaliana


Alignment Length:369 Identity:91/369 - (24%)
Similarity:160/369 - (43%) Gaps:71/369 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LLRGAADIEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPAAQAQPFGSSVNGFGRMGCD 230
            |:....::|:| :||..|                 ::..:|..:|.|:...:||..|.||....|
plant   445 LIPAEEELEKQ-RQLMAH-----------------LENLVAKEWPHAKLYLYGSCANSFGFPKSD 491

  Fly   231 LDLILRFDSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRIL 295
            :|:.|..:.|...|        |.::....|.|.:...|                    :|:.:.
plant   492 IDVCLAIEGDDINK--------SEMLLKLAEILESDNLQ--------------------NVQALT 528

  Fly   296 QARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSP 360
            :|||||:|.......:..|:.::|:.....::||..:.::|.|:|.|.|.::.||::..:.....
plant   529 RARVPIVKLMDPVTGISCDICINNVLAVVNTKLLRDYAQIDVRLRQLAFIVKHWAKSRRVNETYQ 593

  Fly   361 GRWISNFSLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRL-GFRSRN 424
            |. :|:::...:.:.||||.|.||||.:    :..||..| |..|.|.||:..||||| .|.|.|
plant   594 GT-LSSYAYVLMCIHFLQQRRPPILPCL----QEMEPTYS-VRVDNIRCTYFDNVDRLRNFGSNN 652

  Fly   425 QSSLSELLLQFFEFYS-QFDFHNRAISLNEGKPLSK----------PDHSAMYIVNPLEQLLNVS 478
            :.:::||:..||.::: ..|:....:|:..|..|.|          .|...:.|.:|.|...::.
plant   653 RETIAELVWGFFNYWAYAHDYAYNVVSVRTGSILGKREKDWTRRVGNDRHLICIEDPFETSHDLG 717

  Fly   479 KNVSLEECERLRIEVRNAAWVLESEVENAS------VPE-GDGQ 515
            :.|.......||.|...||.::..:....:      :|| .:||
plant   718 RVVDKFSIRVLREEFERAARIMHQDPNPCAKLLEPYIPEDNNGQ 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 28/139 (20%)
PAP_assoc 427..477 CDD:281779 13/60 (22%)
AT2G45620NP_566048.1 NT_PAP_TUTase 456..566 CDD:143392 31/154 (20%)
PAP_assoc 655..714 CDD:281779 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12271
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.