DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and TUT1

DIOPT Version :10

Sequence 1:NP_569904.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_073741.3 Gene:TUT1 / 64852 HGNCID:26184 Length:874 Species:Homo sapiens


Alignment Length:30 Identity:8/30 - (26%)
Similarity:14/30 - (46%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SMIFNIIYTIM-VVSVVIP--KPWRREKET 240
            |.::.::|... :...|:|  .||.|...|
Human   339 SQVYPVLYREKEIPPTVLPNKSPWCRNPNT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_569904.1 NT_PAP_TUTase 193..333 CDD:143392 8/30 (27%)
PAP_assoc 427..>461 CDD:427532
TUT1NP_073741.3 zf-met 16..40 CDD:463736
RRM_TUT1 54..127 CDD:409721
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..146
DUF3729 <233..310 CDD:372164
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..334
TRF4 <357..>553 CDD:227585 5/12 (42%)
KA1, binds the bulging loops of U6 snRNA but is dispensable for terminal uridylyltransferase activity. /evidence=ECO:0000269|PubMed:28589955 598..874
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 638..662
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 705..761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.