DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and Gld2

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001262829.1 Gene:Gld2 / 42602 FlyBaseID:FBgn0038934 Length:1364 Species:Drosophila melanogaster


Alignment Length:482 Identity:108/482 - (22%)
Similarity:184/482 - (38%) Gaps:142/482 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 EQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLIL---- 235
            :|.:.:|:        |:||...|  :.......:|.......|||::.||....|:|:.:    
  Fly   948 QQTRHVYK--------IKMRLWRA--IYTVAMKNYPRYGLYLVGSSISYFGSKCSDMDICMLACT 1002

  Fly   236 --RFDSDMGAKIPLEAAVPSRLVYH---TKENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRIL 295
              ..||.|.|            |||   .||.|  ||:      ..|.|.            .::
  Fly  1003 NPNIDSRMEA------------VYHLHVMKELL--GRT------NMFQDF------------NLI 1035

  Fly   296 QARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSP 360
            :|||||:::......:|||::.:|..|...:.|||.:.::|.||||:..|:::|||...:.| :.
  Fly  1036 EARVPILRFTDRCHKVEVDINFNNSVGIRNTHLLYCYSQLDWRVRPMALTVKQWAQYHNINN-AK 1099

  Fly   361 GRWISNFSLTCLVMFFLQ-QLRQPILPTI--------GALAKAAEPGDSRVTEDGINCTFTRNVD 416
            ...||::||..:|:.||| ....|:||.:        |.|    :|.|....:        .|..
  Fly  1100 NMTISSYSLMLMVIHFLQVGASPPVLPCLHNLYPEKFGLL----QPNDFGYVD--------MNEV 1152

  Fly   417 RLGFRSRNQSSLSELLLQFFEFYSQFDFHNRAISLNEG--------KPLSKPDH-----SAMYIV 468
            ...::|.|..:|.:|||.|..:||.||:...|||:..|        :..:.|.:     :.:.|.
  Fly  1153 MAPYQSDNSQTLGDLLLSFLHYYSVFDYGKYAISIRVGGVLPIEVCRAATAPKNDIHQWNELCIE 1217

  Fly   469 NPLEQLLNVSKNV-SLEECERLRI----------EVRNAAWVLESEVENASVPEGDGQELSCGLL 522
            .|.:| .|.:::| ..:..||::.          ..||.:.:.|         :.||..:     
  Fly  1218 EPFDQ-TNTARSVYDTDTFERIKTIFVASYRRLDSTRNLSAIFE---------DYDGPTI----- 1267

  Fly   523 NLFKHPEKAVIRPNMFFKPRMVEVSDLFE-------QKEAGATSSSTPPTPAITYKSASVRQQVQ 580
                          :..:|.:....:|:|       .....:.|:|..|:|         |..:.
  Fly  1268 --------------LMQQPSVDSEIELYEGQHHRLLPNRGSSRSNSAIPSP---------RPSIL 1309

  Fly   581 SIKAATRSELKQLRGSGSSVPTSSPNN 607
            .:..||.:....:.........|..||
  Fly  1310 MVDKATTAIWDDINNKPDHPVLSHSNN 1336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 38/148 (26%)
PAP_assoc 427..477 CDD:281779 17/62 (27%)
Gld2NP_001262829.1 NT_PAP_TUTase 954..1073 CDD:143392 40/160 (25%)
PAP_assoc 1163..1224 CDD:281779 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.