DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and wisp

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001285144.1 Gene:wisp / 32152 FlyBaseID:FBgn0260780 Length:1373 Species:Drosophila melanogaster


Alignment Length:437 Identity:106/437 - (24%)
Similarity:179/437 - (40%) Gaps:99/437 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 RGAADIEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLD 232
            |||       ||.:     |:..::||....|.:... ..||...:....||::.|||....|:|
  Fly   980 RGA-------QQTH-----NKFKLKMRLWRYLYLWMH-QPMFERYRICLVGSTITGFGTDSSDID 1031

  Fly   233 LILRFDSDMGAKIPLEAAVPSRLVYHTKENLSNGR-----------SQTQRHMECFGDMLHLFLP 286
            :.|         :|.:...|.:..||...:..|.:           :...:..|.|.|.      
  Fly  1032 MCL---------LPEQGVHPHQHQYHQHHHFHNEKRTEALIILTLFNAVLKDTEVFQDF------ 1081

  Fly   287 GVCHVRRILQARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQ 351
                  .:::|||||:::......:||||:.:|..|...:.||.::.:||.|.|||...::.|||
  Fly  1082 ------NLIEARVPILRFKDISNGIEVDLNFNNCVGIKNTYLLQLYAQMDWRTRPLVVIVKLWAQ 1140

  Fly   352 TCGLTNPSPGRWISNFSLTCLVMFFLQQLRQP-ILPTIGAL-AKAAEPGDSRVTEDGINCTFTRN 414
            ...: |.:....||::||..:|:.:||....| :||.:.:| .:..:.|.    :|.::......
  Fly  1141 YHDI-NDAKRMTISSYSLVLMVLHYLQHACVPHVLPCLHSLYPEKFQLGQ----QDCLDLDLIEP 1200

  Fly   415 VDRLGFRSRNQSSLSELLLQFFEFYSQFDFHNRAISLNEGKPLSKPDHSAMYIVNPLEQLLNVSK 479
            ::  .:::.|..:|.|.||.||::||.|||.|.|||:..|..|  |..:.....:|...:.. .|
  Fly  1201 IE--PYQALNTQTLGEHLLGFFKYYSTFDFRNFAISIRTGGVL--PVSTCRMAKSPKNDVYQ-WK 1260

  Fly   480 NVSLEECERLRIEVRNAAWVLESEVENASVPEGDGQEL--------------SCGLLNLFKHPEK 530
            .:::||    ..::.|.|         .||.:|...|.              :..|..:|: |..
  Fly  1261 ELNIEE----PFDLSNTA---------RSVYDGPTFERVKAVFLISARRLDHTLDLATIFR-PIH 1311

  Fly   531 AVIRPNMFFKPRMVEVSDLFE----------QKEAGATSSSTPPTPA 567
            .|  |..|  |::.:....||          |:.||.......|.|:
  Fly  1312 HV--PEHF--PQLQQHQQQFEQQLHHPISGQQRSAGGGGDGANPVPS 1354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 34/150 (23%)
PAP_assoc 427..477 CDD:281779 19/49 (39%)
wispNP_001285144.1 NT_PAP_TUTase 987..1122 CDD:143392 35/156 (22%)
PAP_assoc 1211..1272 CDD:281779 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453080
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12271
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.