DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and Tent4b

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_006255323.1 Gene:Tent4b / 307745 RGDID:1309587 Length:700 Species:Rattus norvegicus


Alignment Length:361 Identity:78/361 - (21%)
Similarity:130/361 - (36%) Gaps:102/361 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 RAAGGGRRSPKLVANTAPALLSLDGT----RQVDQRHLLGLLRGAADIEEQVQQLYEHTRLNELG 190
            |||||||      |:....:.|  ||    |..:|        |...:.|::...||:.......
  Rat   170 RAAGGGR------ADGGGGVYS--GTPWKRRNYNQ--------GVVGLHEEISDFYEYMSPRPEE 218

  Fly   191 IRMRFLAALQVQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRL 255
            .:||.....:::..|..::|:|..|.|||...|......|:||:                     
  Rat   219 EKMRMEVVSRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLV--------------------- 262

  Fly   256 VYHTKENLS--NGRSQTQRHMECFGDMLHLFLPGVCHVRRILQARVPIIKYHHEHLDLEVDLSMS 318
            |:...|||.  ......::|.....|          .|:.:.:|.|||||......:::||:|.:
  Rat   263 VFGKWENLPLWTLEEALRKHKVADED----------SVKVLDKATVPIIKLTDSFTEVKVDISFN 317

  Fly   319 NLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQLRQP 383
            ...|...::|:..|.:..|.:..|...::::.....|.....| .|.::||..:.:.|||     
  Rat   318 VQNGVRAADLIKDFTKKYPVLPYLVLVLKQFLLQRDLNEVFTG-GIGSYSLFLMAVSFLQ----- 376

  Fly   384 ILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQFFEFYSQ-FDFHNR 447
                :.....|..|.    |..|:                       ||::|||.|.: |::...
  Rat   377 ----LHPREDACIPN----TNYGV-----------------------LLIEFFELYGRHFNYLKT 410

  Fly   448 AISLNEGKPLSKPDH-----------SAMYIVNPLE 472
            .|.:.:|......|.           |.:||.:||:
  Rat   411 GIRIKDGGSYVAKDEVQKNMLDGYRPSMLYIEDPLQ 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 31/141 (22%)
PAP_assoc 427..477 CDD:281779 15/58 (26%)
Tent4bXP_006255323.1 NT_PAP_TUTase 221..331 CDD:143392 31/140 (22%)
PAP_assoc 389..449 CDD:281779 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.