DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and TUT4

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:XP_005270733.1 Gene:TUT4 / 23318 HGNCID:28981 Length:1652 Species:Homo sapiens


Alignment Length:275 Identity:77/275 - (28%)
Similarity:130/275 - (47%) Gaps:35/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 FGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDML 281
            ||||.||||....|||:.:..:....|:           ..:.||.:.|.....:||        
Human   996 FGSSKNGFGFRDSDLDICMTLEGHENAE-----------KLNCKEIIENLAKILKRH-------- 1041

  Fly   282 HLFLPGVCHVRRILQARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTI 346
                ||:.::..|..|:|||:|:.|....||.|:|:.|....:.:.:|..:..:||||:.|.:|:
Human  1042 ----PGLRNILPITTAKVPIVKFEHRRSGLEGDISLYNTLAQHNTRMLATYAAIDPRVQYLGYTM 1102

  Fly   347 RRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTEDGINCTF 411
            :.:|:.|.:.:.|.|. :|:::...:|::||||.:.|::|.:..:....:.....|  ||.|..|
Human  1103 KVFAKRCDIGDASRGS-LSSYAYILMVLYFLQQRKPPVIPVLQEIFDGKQIPQRMV--DGWNAFF 1164

  Fly   412 TRNVDRLGFR----SRNQSSLSELLLQFFEFYS-QFDFHNRAISLNEGKPLSKPD----HSAMYI 467
            ....:.|..|    .:|..||.||.|....||: :|||....||:.:.|.|:..:    ...:.|
Human  1165 FDKTEELKKRLPSLGKNTESLGELWLGLLRFYTEEFDFKEYVISIRQKKLLTTFEKQWTSKCIAI 1229

  Fly   468 VNPLEQLLNVSKNVS 482
            .:|.:...|:...||
Human  1230 EDPFDLNHNLGAGVS 1244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 32/115 (28%)
PAP_assoc 427..477 CDD:281779 16/54 (30%)
TUT4XP_005270733.1 NT_PAP_TUTase 375..487 CDD:143392
PAP_assoc 628..677 CDD:281779
NT_PAP_TUTase 971..1089 CDD:143392 32/115 (28%)
PAP_assoc 1184..1237 CDD:281779 16/52 (31%)
PTZ00368 <1280..1375 CDD:173561
CytochromB561_N 1375..>1516 CDD:286826
DUF1421 <1383..1650 CDD:284607
FAM75 1423..>1484 CDD:291323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.