DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and Y34F4.3

DIOPT Version :10

Sequence 1:NP_569904.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_497314.1 Gene:Y34F4.3 / 189592 WormBaseID:WBGene00021338 Length:121 Species:Caenorhabditis elegans


Alignment Length:85 Identity:21/85 - (24%)
Similarity:39/85 - (45%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   418 LGFRSRNQSSLSELLLQFFE---------FYSQFDFHNRAISLNEGKPLSKPDHSAMY---IVNP 470
            |.||.::::|:.:|.:.|.:         :.:.||:....|.:...|...|||....|   |.:|
 Worm     3 LSFRCQSRASVVDLFVGFLDSWILGFLDCYATYFDYSTNFIQMVSKKLEYKPDRWCKYPMCIADP 67

  Fly   471 LEQLLNVSKNVSLEECERLR 490
            .:...|:.:.|.|:..|.:|
 Worm    68 FKTDHNLEQGVVLQMFEFIR 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_569904.1 NT_PAP_TUTase 193..333 CDD:143392
PAP_assoc 427..>461 CDD:427532 8/42 (19%)
Y34F4.3NP_497314.1 PAP_assoc 25..72 CDD:427532 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.