DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and mut-2

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_491834.1 Gene:mut-2 / 187005 WormBaseID:WBGene00003499 Length:441 Species:Caenorhabditis elegans


Alignment Length:349 Identity:74/349 - (21%)
Similarity:133/349 - (38%) Gaps:89/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDM 280
            |.||:|.|......|||:.:.        ||..|.|        .|....||:.|....:.....
 Worm    91 PTGSTVTGLATKNSDLDVAIH--------IPQAARV--------LEQEERGRNITDDERQASWRE 139

  Fly   281 LHLFLPGVC-----------------HVRRILQARVPIIKYHH-EHLDLEVDLSMSN-LTGFYMS 326
            :.|.:..:.                 |..:::||::.|:|... :.:|.::.:.|.. |:..:.|
 Worm   140 IQLEILQIVRLNLQNDEQINSRINWEHGIQLVQAQIQILKVMTVDGIDCDISVVMDRFLSSMHNS 204

  Fly   327 ELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQ-QLRQPILPTIGA 390
            .|:.....:|.|..||...:::||.:..:.:|..|.: ::::|..||:.||| ....||||.:..
 Worm   205 FLIRHLAHIDGRFAPLCAIVKQWAASTKVKDPKDGGF-NSYALVLLVIHFLQCGTFPPILPNLQE 268

  Fly   391 LAKAAE--PGDSRVTEDGIN--CTFTRNVDRLGFRSRNQSSLSELLLQFFEFYSQFDFHNRAI-- 449
            :.|...  ..|.:|....:|  ....:.:.|:   :.|.:.|:.|.::|..:||.|:|....|  
 Worm   269 IFKKDNFIAWDDKVYPSILNFGAPLPKPLPRI---APNNAPLARLFIEFLYYYSMFNFKENYIGA 330

  Fly   450 ------------------SLNEGKPLSKP--DHSAMYIVNPLEQLLNVSK--------------- 479
                              |.|:...:..|  :|:....|..|.::.:|.:               
 Worm   331 RPVMVMDRRTSQNNMVRSSTNKEVCIQDPFDEHNPGRTVRTLNRIKDVMRSTYQKFLPVEGSEFT 395

  Fly   480 --------NVSLEECERLRIEVRN 495
                    |:|.|..:..|.||||
 Worm   396 FPTLDDIINMSPEVPKPSRAEVRN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 27/135 (20%)
PAP_assoc 427..477 CDD:281779 14/71 (20%)
mut-2NP_491834.1 TRF4 74..>376 CDD:227585 65/304 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284150at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.