DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and F43H9.3

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_505067.1 Gene:F43H9.3 / 179181 WormBaseID:WBGene00018399 Length:413 Species:Caenorhabditis elegans


Alignment Length:279 Identity:64/279 - (22%)
Similarity:106/279 - (37%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 AAQAQPFGSSVNGFGRMGCDLDLIL---------RFDSDMGAKIPLEAAVPSRLVYHTKENLSNG 266
            |.:..|.||.|..|.....|.|.:.         ||..|                :|...:..  
 Worm    91 AVELIPVGSMVTNFVNKQSDFDFVFFPKRDDQRHRFLRD----------------FHQNPSFK-- 137

  Fly   267 RSQTQRHMECFGDMLH-----LFLPGVCHVRRILQ---ARVPIIKYHH-EHLDLEVDLSMSNLTG 322
                |..|..|..::.     |..|    |.:|::   .|||:|...: ..|.::|.....|...
 Worm   138 ----QNFMSVFAKLIERESAKLGEP----VEKIVELPRMRVPLIIVRYISGLSIDVQFPEENYHA 194

  Fly   323 FYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQLRQ----P 383
            ...:.|:.|:...|.|...|...:|.......:.|...| .:|::.|..||:.|||..:.    |
 Worm   195 IRNTHLMKMYKLCDHRFTLLFLWLRAICDKLEVRNSKYG-LLSSYHLLLLVVHFLQSEQALSPWP 258

  Fly   384 ILPTIGALAK------AAEPGDSRVTEDGINCTFTRN--VDRLGFRSRNQSSLSELLLQFFEFYS 440
            :||   .|||      .:|...|:|.|    ...:.|  :....:.|.|:.::|||:::|.::|:
 Worm   259 VLP---VLAKTHPNLVTSEIPISKVAE----LIKSENPCLSDFSWTSHNKMAISELIIRFVDYYN 316

  Fly   441 QFDFHNRAISLNEGKPLSK 459
            .|:....||.:.:|..|.:
 Worm   317 HFNAAKEAIYIEKGLALKR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 28/139 (20%)
PAP_assoc 427..477 CDD:281779 10/33 (30%)
F43H9.3NP_505067.1 NT_Pol-beta-like 79..204 CDD:386233 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.