DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and cid-1

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_498099.1 Gene:cid-1 / 175707 WormBaseID:WBGene00019629 Length:1425 Species:Caenorhabditis elegans


Alignment Length:324 Identity:78/324 - (24%)
Similarity:147/324 - (45%) Gaps:41/324 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DIEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMF-PAAQAQPFGSSVNGFGRMGCDLDLIL 235
            ||::.:.:.|....|:|..::|......::|..:...: .......|||.:.|......|:|:.|
 Worm  1008 DIDDMIDKYYHENILDERRLKMLDHKIDELQSFLRKNYREDVTLTTFGSVMTGLSVNCSDIDICL 1072

  Fly   236 RF-DSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQARV 299
            || |.|    :|.:......::..|:..|          .:|     ||    |..|:.|:.|:|
 Worm  1073 RFGDGD----VPPKDLTAKEVIQKTESVL----------RKC-----HL----VKRVQAIVTAKV 1114

  Fly   300 PIIKYHHEHLD---LEVDLSMSNLTGFYMSELL--YMFGEMDPRVRPLTFTIRRWAQTCGLTNPS 359
            ||:|:..:..:   ::||:|..|:...|.:.||  |.....|.|...|...::.||:.|.:.:.|
 Worm  1115 PIVKFQVKLSNGAIIDVDISYYNILAIYNTALLKEYSLWTPDKRFAKLALFVKTWAKNCEIGDAS 1179

  Fly   360 PGRWISNFSLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTE--DGINCTFTRNVDRLGFR- 421
            .|. :|::....:::.:||....|:||.:....::    |:|...  |..:.:|.:....|..| 
 Worm  1180 RGS-LSSYCHVIMLISYLQNCDPPVLPRLQEDFRS----DNRERRLVDNWDTSFAQVETSLLQRW 1239

  Fly   422 SRNQSSLSELLLQFFEFYSQFDFHNRAISLNEGKPLSKPDHS---AMYIVNPLEQLLNVSKNVS 482
            .:|:.|.::||:.:|::||:|||.|..:.......|||.:..   .:.:.:|.:...|:|..|:
 Worm  1240 PKNKESCAQLLIGYFDYYSRFDFRNFVVQCRREMILSKMEKEWPRPLCVEDPFDLSHNLSSGVN 1303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 35/146 (24%)
PAP_assoc 427..477 CDD:281779 14/52 (27%)
cid-1NP_498099.1 PAP_assoc 574..625 CDD:367682
NT_PAP_TUTase 1029..1151 CDD:143392 34/144 (24%)
TRF4 1034..>1317 CDD:227585 72/298 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.