DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and gld-4

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_492446.3 Gene:gld-4 / 172735 WormBaseID:WBGene00014115 Length:845 Species:Caenorhabditis elegans


Alignment Length:297 Identity:56/297 - (18%)
Similarity:105/297 - (35%) Gaps:63/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 IEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMF--PAAQAQPFGSSVNGFGRMGCDLDLIL 235
            :.|::..:|...:.||:..|:|.....:|:.::...:  ...:...|||..........|:|:::
 Worm    80 LHEEIVDMYHWIKPNEIESRLRTKVFEKVRDSVLRRWKQKTIKISMFGSLRTNLFLPTSDIDVLV 144

  Fly   236 RFDSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQARVP 300
            ..|..:|..                   .:..::|.|.:|.......:.:.|        .|.||
 Worm   145 ECDDWVGTP-------------------GDWLAETARGLEADNIAESVMVYG--------GAFVP 182

  Fly   301 IIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWIS 365
            |:|.......|.:|:|.:.:.|...:..:....|..|.:.||...::::.....|.....| .:|
 Worm   183 IVKMVDRDTRLSIDISFNTVQGVRAASYIAKVKEEFPLIEPLVLLLKQFLHYRNLNQTFTG-GLS 246

  Fly   366 NFSLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSE 430
            ::.|..|::.|.|             ..|.......:.:.|:|                   |..
 Worm   247 SYGLVLLLVNFFQ-------------LYALNMRSRTIYDRGVN-------------------LGH 279

  Fly   431 LLLQFFEFYS-QFDFHNRAISLNEGKPLSKPDHSAMY 466
            |||:|.|.|| :|:|....||..:...:.|....|.|
 Worm   280 LLLRFLELYSLEFNFEEMGISPGQCCYIPKSASGARY 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 22/141 (16%)
PAP_assoc 427..477 CDD:281779 15/41 (37%)
gld-4NP_492446.3 NT_PAP_TUTase 100..213 CDD:143392 22/139 (16%)
PAP_assoc 276..336 CDD:281779 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.