DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and pup-3

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_491621.1 Gene:pup-3 / 172207 WormBaseID:WBGene00019082 Length:482 Species:Caenorhabditis elegans


Alignment Length:366 Identity:82/366 - (22%)
Similarity:146/366 - (39%) Gaps:98/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VDQRHLLGLLRGAADIEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPAAQAQPFGSSVN 222
            ||..|...|.:.||.....::|.|..:..                 .|.|.:||           
 Worm    74 VDTHHQEPLRKAAAQFRAVMKQEYPDSTC-----------------FITGSYPA----------- 110

  Fly   223 GFGRMGCDLDLILRFDSDMGAKIP-LEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDMLHLFLP 286
                 |.|   |...|.|...|:| ||.|.|...:...::.||           |:..:.     
 Worm   111 -----GVD---IFSSDIDFTVKVPTLEGANPFLKLMQLRKELS-----------CYYTIF----- 151

  Fly   287 GVCHVRRILQARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQ 351
            ...:|::   ..:|:::..|....:.:|:::.|.|....::||..:.::|.|...|...::.||.
 Worm   152 SKAYVQK---GNIPVLQLMHAETKVSIDVTIDNDTSKRNTQLLAFYSQLDTRFPLLCKAMKAWAA 213

  Fly   352 TCGLTNPSPGRWISNFSLTCLVMFFLQQLR-----QPILPTIGALAKAAEPGDSRVTEDGINCTF 411
            :||:...|.|| :::|||..:::.:||.::     |.|.|.:.        ||..|.:|..   .
 Worm   214 SCGVEGASRGR-LNSFSLCLMLIHYLQTVQVLLNIQEIFPELN--------GDIVVEDDNY---M 266

  Fly   412 TRN-----VDRLGFR-SRNQSSLSELLLQFFEFYSQFDFHNRAISLNEGKPLSK----------- 459
            .|:     :::..|. ::|.|||:.|.:.|.::||:|:|....||:..|..|.|           
 Worm   267 KRDLKIEILEKGAFDFNQNTSSLAVLFIGFMKYYSEFNFKWNWISIKHGNVLKKKWSKTRVPKNG 331

  Fly   460 -PDHSAMYIVNPLEQLLNVSKNVS-----LEECERLRIEVR 494
             |......:|  .:.||.:.:|.:     ....||:::|.|
 Worm   332 MPKDCRFIVV--ADPLLEIPRNCAGTVRQQNYMERIQLEFR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 26/140 (19%)
PAP_assoc 427..477 CDD:281779 17/61 (28%)
pup-3NP_491621.1 TRF4 90..>374 CDD:227585 76/350 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D284150at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.