DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and C53A5.16

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001263887.1 Gene:C53A5.16 / 13216596 WormBaseID:WBGene00194706 Length:381 Species:Caenorhabditis elegans


Alignment Length:275 Identity:63/275 - (22%)
Similarity:104/275 - (37%) Gaps:50/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 PAAQAQPFGSSVNGFGRMGCDLDLILRFDSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHM 274
            |..:..|.||:.|.......||||             .|..:|.:.....|:.:.......|..|
 Worm    83 PEIRLVPIGSAANLLLNNSSDLDL-------------FEVLLPFKNSRQWKDFMKKFSENEQFRM 134

  Fly   275 ECFGDMLHLFLP----GVCHVRRILQARVPIIKYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEM 335
            . :.:.::|.|.    |..| ....:||:|:|::..:.. |:||:...|:.....|..:....|.
 Worm   135 S-YMNKINLQLKAKKIGFSH-DPYYKARIPLIRFFSKRW-LQVDIQFGNIAPIRSSLFVRTCVEY 196

  Fly   336 DPRVRPLTFTIRRWAQTCGLTNPSPGRWISNFSLTCLVMFFLQQLRQPILPTI------------ 388
            |.||..|...:....|..|:.: |.....|.:.:..||:.|||.:..|:||.|            
 Worm   197 DERVGLLIHWLTNKFQEAGILS-SKNLKFSRYHVNILVIHFLQAIPYPVLPQIIQLSPWLSTKND 260

  Fly   389 --GALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELLLQFFEFYSQFDFHNRAISL 451
              .|:......|...|.    ||:          ...|:.|:..|.:|..:::||.|||..||. 
 Worm   261 WNNAVKVLTRQGSVYVP----NCS----------EVPNEQSVGALAVQLIDYFSQIDFHTNAID- 310

  Fly   452 NEGKPLSKPDHSAMY 466
            ..|..:.|.::..::
 Worm   311 TRGNVVDKLENDPLH 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 27/126 (21%)
PAP_assoc 427..477 CDD:281779 12/40 (30%)
C53A5.16NP_001263887.1 NT_Pol-beta-like 73..194 CDD:299849 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.