DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MTPAP and Tent2

DIOPT Version :9

Sequence 1:NP_001259129.1 Gene:MTPAP / 31081 FlyBaseID:FBgn0024360 Length:612 Species:Drosophila melanogaster
Sequence 2:NP_001348466.1 Gene:Tent2 / 100715 MGIID:2140950 Length:484 Species:Mus musculus


Alignment Length:335 Identity:85/335 - (25%)
Similarity:163/335 - (48%) Gaps:41/335 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 IEEQVQQLYEHTRLNELGIRMRFLAALQVQQAIAGMFPAAQAQPFGSSVNGFGRMGCDLDLILRF 237
            :.:|:.:|:|..:.....::.:.|...|:|:.|..:||.::....|||:||||....|.||.|..
Mouse   156 LSQQILELFETCQQQASDLKKKELCRAQLQREIQLLFPQSRLFLVGSSLNGFGARSSDGDLCLVV 220

  Fly   238 DSDMGAKIPLEAAVPSRLVYHTKENLSNGRSQTQRHMECFGDMLHLFLPGVCHVRRILQARVPII 302
            ..:           |.....:.|....:..:...:|. |      ..|.|.....::::|:|||:
Mouse   221 KEE-----------PCFFQVNQKTEARHILTLVHKHF-C------TRLSGYIERPQLIRAKVPIV 267

  Fly   303 KYHHEHLDLEVDLSMSNLTGFYMSELLYMFGEMDPRVRPLTFTIRRWAQTCGLTNPSPGRWISNF 367
            |:..:...:|.||:::|..|...:.||..:..::.|||||...|::||....:.:.|.|. :|::
Mouse   268 KFRDKVSCVEFDLNVNNTVGIRNTFLLRTYAYLENRVRPLVLVIKKWASHHDINDASRGT-LSSY 331

  Fly   368 SLTCLVMFFLQQLRQPILPTIGALAKAAEPGDSRVTEDGINCTFTRNVDRLGFRSRNQSSLSELL 432
            ||..:|:.:||.|.:||||::..:..     :|..|...::.......:...:.|:|:|||.:||
Mouse   332 SLVLMVLHYLQTLPEPILPSLQKIYP-----ESFSTSVQLHLVHHAPCNVPPYLSKNESSLGDLL 391

  Fly   433 LQFFEFY-SQFDFHNRAISLNEGKPLSKPD-----HSAMYIVNPLE-----------QLLNVSKN 480
            |.|.::| ::||::.:.||:.|.|.:.:||     :..:.:..|.:           |..::.|:
Mouse   392 LGFLKYYATEFDWNTQMISVREAKAIPRPDDMEWRNKYICVEEPFDGTNTARAVHEKQKFDMIKD 456

  Fly   481 VSLEECERLR 490
            ..|:..:||:
Mouse   457 QFLKSWQRLK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MTPAPNP_001259129.1 NT_PAP_TUTase 193..333 CDD:143392 35/139 (25%)
PAP_assoc 427..477 CDD:281779 17/66 (26%)
Tent2NP_001348466.1 Nuclear localization signal. /evidence=ECO:0000255 76..92
TRF4 121..>468 CDD:227585 85/335 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.