DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and CD81

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_004347.1 Gene:CD81 / 975 HGNCID:1701 Length:236 Species:Homo sapiens


Alignment Length:225 Identity:61/225 - (27%)
Similarity:102/225 - (45%) Gaps:11/225 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILE------AQSFYIGVYVLIGISIVM 76
            |:||.||.||.|.|:....:..:.:|||.:|...: |..||      ..:||:|:|:||.:..||
Human     9 CIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTN-LLYLELGDKPAPNTFYVGIYILIAVGAVM 72

  Fly    77 MAVSFLGCLSALMENTLALFVFVGTQVFGFIA-IVAGSAVLLQFSTINSSLQPLLNVSLRGFVAT 140
            |.|.||||..|:.|:...|..|....|..|.. :.||....:....|...::...:.:|:..|..
Human    73 MFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVD 137

  Fly   141 SEYTYSNYVLTMIQENIGCCGATGPWDYLD--LRQPLPSSCRDTVSGNAFFNGCVDELTWFFEGK 203
            .:...:..|:....|.:.|||::.......  |:..|..|..:.:| |.|...|..::...|.||
Human   138 DDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIIS-NLFKEDCHQKIDDLFSGK 201

  Fly   204 TGWIVALAMTLGLLNVICAVMSFVLVQAVK 233
            ...|...|:.:.::.:...::|.||...::
Human   202 LYLIGIAAIVVAVIMIFEMILSMVLCCGIR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 61/222 (27%)
tetraspanin_LEL 116..204 CDD:239401 17/89 (19%)
CD81NP_004347.1 Tetraspannin 10..226 CDD:395265 58/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1205716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X522
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.