DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tspan2

DIOPT Version :10

Sequence 1:NP_525037.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_081809.2 Gene:Tspan2 / 70747 MGIID:1917997 Length:221 Species:Mus musculus


Alignment Length:35 Identity:11/35 - (31%)
Similarity:17/35 - (48%) Gaps:5/35 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 PSFDSSTYRVGHTLAQNLCALEMKTEIGAIADFDE 279
            ||. ||...:|||:..    :.:|.....::||.|
Mouse   195 PSI-SSLEEIGHTVED----MHVKDSPSRLSDFQE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_525037.1 Tetraspanin 19..230 CDD:459767
Tspan2NP_081809.2 Tetraspanin 11..212 CDD:459767 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.