DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tspan2

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_072111.1 Gene:Tspan2 / 64521 RGDID:620982 Length:221 Species:Rattus norvegicus


Alignment Length:245 Identity:60/245 - (24%)
Similarity:100/245 - (40%) Gaps:60/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQS-----FYIGVYVLIGISIVMM 77
            |:||.|..||::.|:..:|:.|..:|.|    |...::.|.::.     ||:|:|||:|...:||
  Rat    10 CIKYLLLGFNLLFWLAGSAVIAFGLWFR----FGGTIKDLSSEEKSPEYFYVGLYVLVGAGALMM 70

  Fly    78 AVSFLGCLSALMEN--------TLALFVF---VGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLN 131
            ||.|.||..|:.|:        |..|.:|   |.|.||.||.                     .:
  Rat    71 AVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIG---------------------KD 114

  Fly   132 VSLRGFVATSEYTYSNYV---------LTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNA 187
            |::|...:..|..||:||         |........|||.       :..:.:..:|...:.|: 
  Rat   115 VAIRHVQSMYEEAYSDYVRDRGRGNGTLITFHSAFQCCGK-------ESSEQVQPTCPKELPGH- 171

  Fly   188 FFNGCVDELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEE 237
              ..|:|::......|...|..:.:.:..|.:...:.|.||..|::...:
  Rat   172 --KNCIDKIETIISVKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRD 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 59/238 (25%)
tetraspanin_LEL 116..204 CDD:239401 15/96 (16%)
Tspan2NP_072111.1 Tetraspannin 10..214 CDD:278750 59/238 (25%)
CD81_like_LEL 110..186 CDD:239404 17/106 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1205716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X522
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.