DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Cd151

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_071968.1 Gene:Cd151 / 64315 RGDID:621290 Length:253 Species:Rattus norvegicus


Alignment Length:240 Identity:56/240 - (23%)
Similarity:104/240 - (43%) Gaps:33/240 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFL 82
            |:||.||.:|...|:...|:.|:.:|..|..  :|::.:|.:.::....|:|:...:|:|....|
  Rat    15 CLKYLLFTYNCCFWLAGLAVMAVGIWTLALK--SDYISLLASSTYLATAYILVVAGVVVMVTGVL 77

  Fly    83 GCLSALME--NTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSL-QPLLNVSLRGFVATSEYT 144
            ||.:...|  |.|.|: |:...:...:.|:||....:.:..:|:.| :.|.:..::.:..:....
  Rat    78 GCCATFKERRNLLRLY-FILLLIIFLLEIIAGILAYVYYQQLNTELKENLKDTMIKRYHQSGHEG 141

  Fly   145 YSNYVLTMIQENIGCCGATGPWDYLDLR---------QPLPSSCRDTV---------SGNAF--F 189
            .:|.| ..:|:...|||:....|:.|..         :.:|.||..||         :.|.:  .
  Rat   142 VTNAV-DKLQQEFHCCGSNNSRDWRDSEWIRSGEADSRVVPDSCCKTVVTGCGKREHASNIYKVE 205

  Fly   190 NGCVDELTWFFE------GKTGWIVALAMTLGLLNVICAVMSFVL 228
            .||:.:|..|.:      |..|..:|.....|::...|...|..|
  Rat   206 GGCITKLESFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKL 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 56/240 (23%)
tetraspanin_LEL 116..204 CDD:239401 22/114 (19%)
Cd151NP_071968.1 Tetraspannin 16..244 CDD:395265 52/231 (23%)
CD151_like_LEL 112..220 CDD:239408 21/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.