DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tsp42Ea

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_525012.2 Gene:Tsp42Ea / 59178 FlyBaseID:FBgn0029508 Length:226 Species:Drosophila melanogaster


Alignment Length:242 Identity:54/242 - (22%)
Similarity:101/242 - (41%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGCVKYTLFCFNIVAWMISTALFALTVWLRAE-PGFNDWLRILEAQSFYIGVYVLIGISIVMMAV 79
            |..|||.||.||::..:....|......|.:: ...:|:...|..|...:.:.:|   ..:::.:
  Fly     5 ISMVKYILFIFNLLCSICGILLIVFGALLFSKVRNMDDFAEALRTQQVPVTMIIL---GTIILLI 66

  Fly    80 SFLGCLSALMEN-----TLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVA 139
            |:.||..|:.|:     |.::.:||  .:.|.:|:|           |...:|....:.:.|.|.
  Fly    67 SWFGCCGAIRESYCMSMTYSILLFV--LMIGQLALV-----------IYMWVQKDKYLEIMGDVV 118

  Fly   140 TSEYTY----SNYVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVS---GNAFFNGCVDELT 197
            ...:.:    |:| :..||.::.|||.:|..||....:..||.|.||.:   ...:..||.....
  Fly   119 EKAWNHRTSRSDY-MDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFV 182

  Fly   198 WFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEEQASNYRR 244
            .|::..:..|....:.:..:..:..|.:..|..:::       ||||
  Fly   183 EFWDRNSDIIKYAGLVIAAIEFVGFVFACCLANSIR-------NYRR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 49/226 (22%)
tetraspanin_LEL 116..204 CDD:239401 22/94 (23%)
Tsp42EaNP_525012.2 Tetraspannin 8..217 CDD:278750 49/225 (22%)
tetraspanin_LEL 104..188 CDD:239401 21/84 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.