DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tspan3

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_062767.3 Gene:Tspan3 / 56434 MGIID:1928098 Length:253 Species:Mus musculus


Alignment Length:238 Identity:50/238 - (21%)
Similarity:96/238 - (40%) Gaps:51/238 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVY------VLIGISIVMMA 78
            |..|...|::.|..:..|..:..::...  ::|:      ..|:..||      |:|.:..::..
Mouse    10 KTVLVFLNLIFWGAAGILCYVGAYVFIT--YDDY------DHFFEDVYTLFPAVVIIAVGALLFI 66

  Fly    79 VSFLGCLSALMENT--LALFVFVGTQVF--GFIAIVAGSAVLLQF-STINSSLQPLLNVSLRGFV 138
            :..:||.:.:.|:.  ||.|||:...||  ..:.:|.|.....:. :.::.|:|.:..       
Mouse    67 IGLIGCCATIRESRCGLATFVFILLLVFVTEVVVVVLGYVYRAKVENEVDRSIQKVYK------- 124

  Fly   139 ATSEYTY-------SNYVLTMIQENIGCCGA--TGPWDYLD-----LRQPLP-SSCRDTVSGNAF 188
                 ||       ::..:..:|..:.|||.  ...|:..|     ..|.:| |.||:|...   
Mouse   125 -----TYNGTNSDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETAKS--- 181

  Fly   189 FNGCV-DELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQ 230
            .||.: :....:.||....:|.....: |::||.|.::|..:|
Mouse   182 CNGSLANPSDLYAEGCEALVVKKLQEI-LMHVIWAALAFAAIQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 50/238 (21%)
tetraspanin_LEL 116..204 CDD:239401 20/104 (19%)
Tspan3NP_062767.3 Tetraspannin 9..232 CDD:395265 50/238 (21%)
TM4SF8_like_LEL 104..210 CDD:239416 22/121 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.