DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and tspan9a

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_009291748.1 Gene:tspan9a / 555341 ZFINID:ZDB-GENE-060503-632 Length:336 Species:Danio rerio


Alignment Length:226 Identity:57/226 - (25%)
Similarity:94/226 - (41%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPG----FNDWLRILEAQSFYIGVYVLIGISIVMMA 78
            |:||.:|.||::.|:....|..:.:||....|    |:.....|.|.:      ::|.|..::|.
Zfish   105 CLKYMMFVFNLIFWLCGCGLLGVGIWLSVSQGSFATFSPSFPSLSAAN------MVIAIGAIVMV 163

  Fly    79 VSFLGCLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATSEY 143
            ..|||||.|:.||...|..|.   :...|.::|...:|:.|...:..:.......|:..:|.  |
Zfish   164 TGFLGCLGAIKENKCLLLSFF---IVLLIILLAELILLILFFVYSDKVSENAKQDLKDGLAL--Y 223

  Fly   144 TYSNYV-----LTMIQENIGCCGATGPWDYLDL--RQPLPSSC---------RDTVSGNAFF-NG 191
            ...|.:     ..:||....|||.||..|:.|.  .:.:|..|         |:  |.|.|: .|
Zfish   224 NTDNNIGLRNAWNIIQAEWKCCGVTGYTDWHDALKEKVVPDRCCQEHYQECGRN--STNMFWTRG 286

  Fly   192 CVDELTWFFE------GKTGWIVALAMTLGL 216
            |.:::..:.|      |..|..:.:...||:
Zfish   287 CYEKVEEWLEDNKHLLGTIGMCILVVQLLGM 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 57/226 (25%)
tetraspanin_LEL 116..204 CDD:239401 25/110 (23%)
tspan9aXP_009291748.1 Tetraspannin 105..327 CDD:278750 57/226 (25%)
NET-5_like_LEL 202..299 CDD:239418 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.