DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tsp97E

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:153 Identity:38/153 - (24%)
Similarity:62/153 - (40%) Gaps:28/153 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGI---SIVMMAV 79
            |.|..|...||:..||...|..:.|:.|             |.|....:.::.||   .::::.:
  Fly     7 CSKNALIALNILYVMIGFLLIGVGVYAR-------------AASIVTNLPIVGGILACGVILICI 58

  Fly    80 SFLGCLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATSEYT 144
            |.||...|:..:.:.||         |..|:.....|:||| |.||...:.:...:.|......|
  Fly    59 SMLGLAGAVKHHQVMLF---------FYMIILFMLFLIQFS-IASSCLAVNSEQQQQFAEQGWMT 113

  Fly   145 YSNYVLTMIQENIGCCG--ATGP 165
            ....:...:|:::.|||  ||.|
  Fly   114 VPTDLRKQVQDSLKCCGFNATAP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 38/153 (25%)
tetraspanin_LEL 116..204 CDD:239401 16/52 (31%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 38/153 (25%)
tetraspanin_LEL <121..177 CDD:243179 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.