DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and cd9b

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_005164541.1 Gene:cd9b / 406737 ZFINID:ZDB-GENE-040426-2768 Length:231 Species:Danio rerio


Alignment Length:239 Identity:62/239 - (25%)
Similarity:106/239 - (44%) Gaps:25/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ASDEQLEKQIGCVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQS-FYIGVYVLI 70
            :|.||      |:||.:|.||.:.|:..|.:.|:.:|||.:....::......|: |..|||:||
Zfish     8 SSGEQ------CIKYIIFFFNFMLWLAGTGVLAVGLWLRFDAKTKEFFTAENGQTVFLTGVYILI 66

  Fly    71 GISIVMMAVSFLGCLSALMENTLALFVFVGTQVFGFIAIV------AGSAVLLQFSTINSSLQPL 129
            ....|||.|.||||..|:.|:...|.:|     |.|:.::      ||...|.....|.|.:|..
Zfish    67 VAGAVMMVVGFLGCCGAIKESACMLGLF-----FMFLLVIFAAEVAAGIWGLSNKDKIVSDIQQF 126

  Fly   130 LNVSLRGFVATSEYTYSNYVLTMIQENIGCCGATG-PWDYLDLRQPLPSSCRDTVSGNAFFNGCV 193
            ...:::.:..:.:..... .||.|..::.|||.|| ..|.:.:..|     :.....|....||.
Zfish   127 YTQTVKNYKESPDGPLKE-TLTAIHFSLQCCGPTGLVTDGVSVTCP-----KQEGLANVITTGCS 185

  Fly   194 DELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEE 237
            ..:...|..:...|..:.:.:|::.|...:.|.:|..|:::..:
Zfish   186 SVIQDMFNSRLHVIGGVGIGIGVIMVFGMIFSMLLCCAIRRTRD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 58/221 (26%)
tetraspanin_LEL 116..204 CDD:239401 18/88 (20%)
cd9bXP_005164541.1 Tetraspannin 13..224 CDD:278750 58/221 (26%)
CD9_LEL 113..196 CDD:239405 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1205716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.