DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and cd151l

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_991213.1 Gene:cd151l / 402948 ZFINID:ZDB-GENE-040426-1868 Length:254 Species:Danio rerio


Alignment Length:261 Identity:67/261 - (25%)
Similarity:114/261 - (43%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GASDEQLEKQIG--CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYV 68
            ||::|:.|| .|  |:||.||.||.:.|:...|:.|:.:|...|.  :|::.:|.::.:.:..|:
Zfish     2 GANEEKKEK-CGTICLKYLLFTFNFLFWLAGVAVMAVGIWTVIEK--SDYISLLSSKIYAVSAYI 63

  Fly    69 LIGISIVMMAVSFLGCLSALMENTLALFV-FVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNV 132
            ||...:::|....|||.:...|....|.| ||.......:.|:||....:.:..:|..|:..|..
Zfish    64 LIMAGVIVMITGVLGCCATFKEQRRLLRVYFVLLLCIFLLEILAGVLAYIYYQQLNDELKENLRE 128

  Fly   133 SLRGFVATSEYTYSNYVLTMIQENIGCCGATGPWDYLD---LRQP------LPSSC--------- 179
            ::......||..:....:..:|:...|||:....|::|   :|..      :|.||         
Zfish   129 TMVQKYNQSEQEHVTKAVDKLQQEFKCCGSNSSSDWVDSAWIRSSEADGRLVPDSCCKSPVRKFC 193

  Fly   180 --RDTVSGNAF--FNGCVDELTWF------FEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKK 234
              ||..| |.:  ..||:.:|..|      ..|..|..||....:|:....|      |.:::|.
Zfish   194 GRRDHPS-NIYKVEGGCITKLENFILNHLQIIGAVGVGVASVQIVGMFFTCC------LYRSLKS 251

  Fly   235 E 235
            |
Zfish   252 E 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 59/242 (24%)
tetraspanin_LEL 116..204 CDD:239401 24/115 (21%)
cd151lNP_991213.1 Tetraspannin 15..249 CDD:278750 59/242 (24%)
CD151_like_LEL 112..221 CDD:239408 23/109 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.