DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tsp66E

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:268 Identity:62/268 - (23%)
Similarity:113/268 - (42%) Gaps:62/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGCVKYTLFCFNIVAWMISTALFALTVWLRAEP-GFNDWLRILEA---------QSFYIGVYVLI 70
            :.|.||.|..||.:.:::.|.:|.:.:||..:. .....|:::|:         |:.....|||:
  Fly     7 VWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAYVLL 71

  Fly    71 GISIVMMAVSFLGCLSALMENTLALFVFVGTQVFGFIA-IVAGSAVLLQFSTINSSLQPLLNVSL 134
            .|..||..:||||.|.|:.|:...|..:....:...|| ||||.        :.:..:..:....
  Fly    72 VIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGG--------LGAFFKDKVRAES 128

  Fly   135 RGFVATSEYTYS--------NYVLTMIQENIGCCGATGPWDYLDL-----------RQPLPSSC- 179
            :.|:.|:..:||        :.:...:..|.||||..   ||.|.           .:.:|.:| 
  Fly   129 KNFLQTTITSYSLGENVDATSLMWNQLMGNFGCCGIN---DYHDFDASPAWVNGKGNRTIPDACC 190

  Fly   180 ----------RD------TVSGNAFF-NGCVDELT-WFFEGKTGWIVALAMTLGLLNVICAVMSF 226
                      ||      ....|:|: .||.:..| |....:.  :|.:|:.:|:::::..:::|
  Fly   191 ILKDVAKLVPRDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRE--LVIVAIAVGIVHLVLIILAF 253

  Fly   227 VLVQAVKK 234
            .|.:|..|
  Fly   254 ALCKAFAK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 60/262 (23%)
tetraspanin_LEL 116..204 CDD:239401 22/125 (18%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 60/261 (23%)
uroplakin_I_like_LEL 116..231 CDD:239409 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.