DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and tspan2a

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001018160.1 Gene:tspan2a / 378854 ZFINID:ZDB-GENE-050522-511 Length:211 Species:Danio rerio


Alignment Length:238 Identity:65/238 - (27%)
Similarity:99/238 - (41%) Gaps:56/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEA-QSFYIGVYVLIGISIVMMAVSF 81
            ||||.||.||.:.|:..:.:.|:.:|||.:|.....|...:| ::|:|.||:|||...:||.|.|
Zfish    10 CVKYLLFVFNFIFWLSGSLVLAVGLWLRFDPDTTSLLSENDAPENFFIAVYILIGAGGIMMIVGF 74

  Fly    82 LGCLSALMENTLALFVF-----------VGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLR 135
            .||..|:.|:...|..|           |...||||:   ....::.:......|...:.|    
Zfish    75 FGCFGAVRESQCLLGSFFACLLLIFGAEVAAGVFGFL---NKDQIIKEVQNYYESATKMEN---- 132

  Fly   136 GFVATSEYTYSNYVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVDELTWFF 200
            |.|.||.:          ...:.|||...        .|: .:|.:   ||   ..||..:..||
Zfish   133 GTVITSAF----------HSVLDCCGTES--------SPI-ETCTE---GN---KDCVQAIEDFF 172

  Fly   201 EGK---TGWI---VALAMTLGLLNVICAVMSFVLVQAVKKEEE 237
            ..|   .|::   :|..|.:|:      :.|.||..|::...|
Zfish   173 NEKLFIIGYVGIGIAGVMVIGM------IFSMVLCCAIRNSRE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 63/231 (27%)
tetraspanin_LEL 116..204 CDD:239401 18/90 (20%)
tspan2aNP_001018160.1 Tetraspannin 10..204 CDD:278750 63/231 (27%)
tetraspanin_LEL 110..176 CDD:243179 18/97 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1205716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X522
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.