DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and lbm

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm / 35623 FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster


Alignment Length:234 Identity:49/234 - (20%)
Similarity:95/234 - (40%) Gaps:40/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGCVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRI---LEAQSFYIGVYVLIGISIVMM 77
            :||...::...:||       |.|:..:|.|  |...|:..   .|.:.|.|..|:...:.:|. 
  Fly     1 MGCATTSVKIASIV-------LNAVLGFLAA--GAIGWIAYNADTETEEFVIAAYIACSLILVF- 55

  Fly    78 AVSFLGCLSALMEN-----TLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGF 137
              :.||..:|:.|:     |.|:|:.    :...:.||:....|.:|..          .|.|..
  Fly    56 --ALLGIFAAIRESVVLTATSAVFLL----ILAILQIVSTCLFLHEFDV----------KSGRDM 104

  Fly   138 VATSEYTYSNYVLTMIQENIGCCGATGPWDYLDLRQPLPSSC---RDTVSGNAFFNGCVDELTWF 199
            |   |..:....:..:|:...|||.:...||:.|...:|.||   ......:.:.:||::::..|
  Fly   105 V---EVAWQANNMDSLQQKHECCGQSSAQDYIHLSLLIPPSCYADLQQTPDHLYLDGCIEKVQSF 166

  Fly   200 FEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEEQ 238
            :|......:.::..|....:||..::..|..:.|.::.:
  Fly   167 YESDKLRFIIVSWVLVAFELICFALAVFLAISFKNKQRR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 47/224 (21%)
tetraspanin_LEL 116..204 CDD:239401 20/90 (22%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 46/218 (21%)
tetraspanin_LEL <109..169 CDD:239401 13/59 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.