DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:167 Identity:41/167 - (24%)
Similarity:63/167 - (37%) Gaps:30/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KYTLF--CFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISI---VMMAV 79
            ||.|.  |..||...:......:|.|..|                 :.||...|.::   .:..|
  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTWGSA-----------------VSVYGSYGSALCGGAVFGV 58

  Fly    80 SFLGCLSAL-MENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATSEY 143
            :|||...|| :....:::..:.:   |.:....|| .|..|:.:...|.......:|...  ...
  Fly    59 AFLGMYVALKVSYKYSIYYLICS---GLVIAALGS-YLFTFTAMREQLMGRFEERMRDLF--ERK 117

  Fly   144 TYSNYVLTMIQENIGCCGATGPWDYL-DLRQPLPSSC 179
            |:|:..:..:....||||..||.||| :....|||||
  Fly   118 THSDDKMQPVHSLFGCCGIEGPQDYLQEEHGALPSSC 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 41/167 (25%)
tetraspanin_LEL 116..204 CDD:239401 20/65 (31%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 41/167 (25%)
tetraspanin_LEL 97..183 CDD:239401 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.