DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tsp39D

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:236 Identity:55/236 - (23%)
Similarity:100/236 - (42%) Gaps:42/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKY-TLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSF-----YIGVYVLIGISIVM 76
            |||| |.||         ..|||||..|....|....|......:|     :....:|:.:...:
  Fly     8 CVKYLTFFC---------NLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAV 63

  Fly    77 MAVSFLGCLSALMENTLAL--FVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVA 139
            ..:.||||..||.|::..:  |..:...:|.| .|..|.|..::.:.::..::...|.:::.:..
  Fly    64 AVICFLGCCGALKESSCMILSFALLAVVIFLF-EIGLGLAGYVKHTGLHQIMESQFNSTMQHYKE 127

  Fly   140 TSEYTYSNYVLTMIQENIGCCGATGP--WDYLDLRQPLPSSC---------RDTVSGNAFFNGCV 193
            .::|   ....|::|..:.|||..||  |:.:.....||::|         ::..:.:|..:||:
  Fly   128 RADY---RDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKECTNTHATQHGCL 189

  Fly   194 DELTWFFEGKTGWIVALAMTLG--------LLNVICAVMSF 226
            .:|....:.||  ::..::.||        :|...|...||
  Fly   190 QKLLEILDSKT--LILASVVLGVAGIQMLTILFACCLYRSF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 55/236 (23%)
tetraspanin_LEL 116..204 CDD:239401 17/98 (17%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 53/233 (23%)
tetraspanin_LEL 104..200 CDD:239401 17/98 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.