DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tsp26A

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster


Alignment Length:183 Identity:47/183 - (25%)
Similarity:77/183 - (42%) Gaps:35/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPG-FNDWLRILEAQSFYIGV---YVLIGISIVMMA 78
            |:||.||..|::.|:.:..:.::.:|..:|.| |.:..|:     .:|.:   :|||.:..|...
  Fly    18 CLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARL-----HFIALDPAFVLIILGGVTFL 77

  Fly    79 VSFLGCLSALMENTL---ALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVAT 140
            :.|:|.:.||.|||.   |..:|:...:...|...|.:.||.....|.......|...:|.:   
  Fly    78 LGFMGSVGALRENTCLLGAYAIFLSVLLIAEIGFCAVAFVLKDKGWIKDQATEGLKAFIRHY--- 139

  Fly   141 SEYTYSNYVLTMIQEN-IGCCGATGP--WDYLDLRQPLPSSCRDTVSGNAFFN 190
            .|......::..|||: :.|||..||  ||                 .|.:||
  Fly   140 REDADQQNLIDWIQEDWLQCCGIDGPKDWD-----------------SNNYFN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 47/183 (26%)
tetraspanin_LEL 116..204 CDD:239401 18/78 (23%)
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 47/183 (26%)
DUF2207 <65..157 CDD:303056 24/94 (26%)
TM4SF9_like_LEL 118..239 CDD:239412 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.