DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tspan9

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001101360.1 Gene:Tspan9 / 312728 RGDID:1304740 Length:330 Species:Rattus norvegicus


Alignment Length:239 Identity:54/239 - (22%)
Similarity:98/239 - (41%) Gaps:36/239 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPG----FNDWLRILEAQSFYIGVYVLIGISIVMMA 78
            |:||.:|.||::.|:....|..:.:||....|    |:.....|.|.:      ::|.|..::|.
  Rat    99 CLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAAN------LVIAIGTIVMV 157

  Fly    79 VSFLGCLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQF----STINSSLQPLLNVSLRGFVA 139
            ..|||||.|:.||...|..|.   :...|.::|...:|:.|    ..:|.:.:..|...|..:..
  Rat   158 TGFLGCLGAIKENKCLLLSFF---IVLLIILLAELILLILFFVYMDKVNENAKQDLKEGLLLYNT 219

  Fly   140 TSEYTYSNYVLTMIQENIGCCGATGPWDYLDL-----RQPLPSSC---------RDTVSGNAFFN 190
            .:.....| ...:||..:.|||.|   ||.|.     ...:|..|         |::.: ..:..
  Rat   220 ENNVGLKN-AWNIIQAEMRCCGVT---DYTDWYPVLGENTVPDRCCMENSQGCGRNSTT-PLWKT 279

  Fly   191 GCVDELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKK 234
            ||.:::..:|:.....:..:.|...::.::....|..|.|.:.:
  Rat   280 GCYEKVKLWFDDNKHVLGTVGMCFLIMQILGMAFSMTLFQHIHR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 54/235 (23%)
tetraspanin_LEL 116..204 CDD:239401 21/105 (20%)
Tspan9NP_001101360.1 Tetraspannin 100..317 CDD:395265 51/230 (22%)
NET-5_like_LEL 196..293 CDD:239418 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.