DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tspan11

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001019433.1 Gene:Tspan11 / 312727 RGDID:1305424 Length:253 Species:Rattus norvegicus


Alignment Length:251 Identity:62/251 - (24%)
Similarity:101/251 - (40%) Gaps:53/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EQLEKQIGCVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISI 74
            ||.:..:..:||.||.||...|:...|:.|:.:|...|...  :|.||.:.:|....||||.:..
  Rat     7 EQDDWLLAHLKYLLFIFNFFFWVGGAAVMAVGIWTLVEKSV--YLSILASSTFAASAYVLIFVGG 69

  Fly    75 VMMAVSFLG----------CLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPL 129
            ::|...|||          |||......||:|:         :.:|||....:.:..::..|:..
  Rat    70 LVMTTGFLGFGAIIREQKSCLSTYFCLLLAIFL---------VELVAGVLAHVYYQRLSDELKRH 125

  Fly   130 LNVSLR---GFVATSEYTYSNYVLTMIQENIGCCGATGPWDYLD---------LRQPLPSSCRDT 182
            |:.:|.   |....:|.|.|   :..:|::..|||:....|:..         :.:.:|.||..|
  Rat   126 LHSTLTEHYGQPGAAEITAS---VDRLQQDFKCCGSNSSADWQHSVYILSQEAIGRQVPDSCCKT 187

  Fly   183 V---------SGNAF--FNGCVDELTWFFE------GKTGWIVALAMTLGLLNVIC 221
            |         ..|.:  ..||:.:|..|..      |..|..||.....|::...|
  Rat   188 VVARCGQRAHPSNIYKVEGGCMAKLEQFLADHLLLMGAVGIGVACLQICGMVLTCC 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 60/243 (25%)
tetraspanin_LEL 116..204 CDD:239401 23/116 (20%)
Tspan11NP_001019433.1 Tetraspannin 16..248 CDD:278750 60/242 (25%)
CD151_like_LEL 112..220 CDD:239408 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.