DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Cd37

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:XP_017444339.1 Gene:Cd37 / 29185 RGDID:62035 Length:396 Species:Rattus norvegicus


Alignment Length:264 Identity:50/264 - (18%)
Similarity:95/264 - (35%) Gaps:68/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EKQIGCVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSF--YIGV--------- 66
            |..:..:||.||.||:..:::...:|....|:           :::..||  ::|:         
  Rat    28 ESCLSLIKYFLFVFNLFFFVLGGLIFCFGTWI-----------LIDKTSFVSFVGLSFVPLQTWS 81

  Fly    67 YVLIGISIVMMAVSFLGCLSALMENTLALFVFVGTQVFGFIA-IVAGSAVLLQFSTINSSLQPLL 130
            .||....::.||::.|||:.||.|....|.::.|..:..|.. |..|..:..|...:...:|.|:
  Rat    82 KVLSVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQELV 146

  Fly   131 NVSLRGFVATSEYTYSNYVLTMIQENIGCCGATGP--WDYLDLRQP-------LPSSCRDTVSGN 186
            ..:::.:....:.|.:.......|..:.|||...|  |:...:.:.       :|.||.::.:.|
  Rat   147 LRTIQSYRTNPDETAAEESWDYAQFQLRCCGWQSPRDWNKAQMLKANGSEELFVPCSCYNSTATN 211

  Fly   187 ------------------------------------AFFNGCVDELTWFFEGKTGWIVALAMTLG 215
                                                .:..||...|..:.......||.:.:.:|
  Rat   212 DSSGFDKLFLSQLSRLGPRAKLRQTADICALPAKAHIYREGCARSLQKWLHNNIISIVGICLGVG 276

  Fly   216 LLNV 219
            ||.|
  Rat   277 LLEV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 49/259 (19%)
tetraspanin_LEL 116..204 CDD:239401 17/132 (13%)
Cd37XP_017444339.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.