DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and TSPAN16

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_036598.1 Gene:TSPAN16 / 26526 HGNCID:30725 Length:245 Species:Homo sapiens


Alignment Length:177 Identity:37/177 - (20%)
Similarity:63/177 - (35%) Gaps:50/177 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LRILEAQSFYIGVYVLIGISIVMMAVSFLGCLSALM------------ENTLALFVFVGTQVFGF 106
            |.:..|...::|...|:           :||::.|:            ..|| ||..:...:...
Human    47 LGLSSAYLLHVGNLCLV-----------MGCITVLLGCAGWYGATKESRGTL-LFCILSMVIVLI 99

  Fly   107 IAIVAGSAVLLQFSTINS-SLQ---PLLNVSLRGFVATSEYTYSNYVLTMIQENIGCCGATGPWD 167
            :.:.|.:.|||.|..:.. :|:   ..|..:.||:....:|:..   ..::.|.:.|||.....|
Human   100 MEVTAATVVLLFFPIVGDVALEHTFVTLRKNYRGYNEPDDYSTQ---WNLVMEKLKCCGVNNYTD 161

  Fly   168 Y------LDLRQPLPSSC-----------RDTVSGNAFF-NGCVDEL 196
            :      :......|.||           || ||.|... .||..:|
Human   162 FSGSSFEMTTGHTYPRSCCKSIGSVSCDGRD-VSPNVIHQKGCFHKL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 37/177 (21%)
tetraspanin_LEL 116..204 CDD:239401 24/103 (23%)
TSPAN16NP_036598.1 Tetraspannin 19..232 CDD:278750 37/177 (21%)
uroplakin_I_like_LEL 120..215 CDD:239409 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.