DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Cd81

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_037219.2 Gene:Cd81 / 25621 RGDID:2315 Length:236 Species:Rattus norvegicus


Alignment Length:230 Identity:63/230 - (27%)
Similarity:100/230 - (43%) Gaps:21/230 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILE------AQSFYIGVYVLIGISIVM 76
            |:||.||.||.|.|:....:..:.:|||.:|.... |..||      ..:||:|:|:||.:..||
  Rat     9 CIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTS-LLYLELGDKPAPSTFYVGIYILIAVGAVM 72

  Fly    77 MAVSFLGCLSALMENTLALFVFVGTQVFGFIA-IVAGSAVLLQFSTINSSLQPLLNVSLRGFVAT 140
            |.|.||||..|:.|:...|..|....|..|.. :.||....:....|...::...:.:|:..|..
  Rat    73 MFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVMD 137

  Fly   141 SEYTYSNYVLTMIQENIGCCGATGPWDYLD--LRQPL-PSSCRDTVSGNAFF----NGCVDELTW 198
            .:...:..|:....|.:.|||:........  ||..| ||      |.|:|.    ..|..::..
  Rat   138 DDANNAKAVVKTFHETLNCCGSNTLTTLTTTVLRNSLCPS------SSNSFTQLLKEDCHQKIDE 196

  Fly   199 FFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVK 233
            .|.||...|...|:.:.::.:...::|.||...::
  Rat   197 LFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 63/227 (28%)
tetraspanin_LEL 116..204 CDD:239401 19/94 (20%)
Cd81NP_037219.2 Tetraspannin 10..226 CDD:395265 60/222 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1205716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X522
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.