DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Cd53

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_036655.1 Gene:Cd53 / 24251 RGDID:2310 Length:219 Species:Rattus norvegicus


Alignment Length:216 Identity:53/216 - (24%)
Similarity:94/216 - (43%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFLG 83
            :||.||.||.:.|:....:....:.|..:..:....|.|   .|.....||:.:..::|.|:|||
  Rat     9 LKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNL---PFLTLGNVLVIVGSIIMVVAFLG 70

  Fly    84 CLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQF-STINSSLQPLLNVSLRGFVATSEYTYSN 147
            |:.::.||...|..|....:...:|.|..:.:|..: ..||:.:...||.|::.:.:.:.   :.
  Rat    71 CMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDSIQHYHSDNS---TR 132

  Fly   148 YVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVDELTWFFEGKTGWIVALAM 212
            .....||..:.|||..|..|::.  .| ||||    ...|...||       ::....|..:..:
  Rat   133 MAWDFIQSQLQCCGVNGSSDWIS--GP-PSSC----PSGADVQGC-------YKKGQAWFHSNFL 183

  Fly   213 TLGLLNV-ICAV----MSFVL 228
            .:|::.: :|.:    |||.|
  Rat   184 YIGIVTICVCVIQVLGMSFAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 53/216 (25%)
tetraspanin_LEL 116..204 CDD:239401 21/88 (24%)
Cd53NP_036655.1 Tetraspannin 9..210 CDD:278750 53/216 (25%)
CD53_like_LEL 104..186 CDD:239417 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.