DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tspan8

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001162150.1 Gene:Tspan8 / 216350 MGIID:2384918 Length:235 Species:Mus musculus


Alignment Length:243 Identity:54/243 - (22%)
Similarity:103/243 - (42%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRIL----EAQSFYIGVYVLIGISIVMMA 78
            |:||::|.||.:.|:..|.:..|.:|:|..   .|...|:    .:.:.:|.|.:||.:..::|.
Mouse     7 CLKYSMFFFNFLFWVCGTLILGLAIWVRVS---KDGKEIITSGDSSTNPFIAVNILIAVGSIIMV 68

  Fly    79 VSFLGCLSALMEN-TLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATSE 142
            :.||||..|:.|: .:.|..|:|..:...:.:.||        .:.::.:|..|..|      :|
Mouse    69 LGFLGCCGAVKESRCMLLLFFIGLLLILILQVAAG--------ILGAAFKPEYNRIL------NE 119

  Fly   143 YTYSN---------------YVLTMIQENIGCCG---ATGPW--DYLDLRQPLPSSCRDTVSGNA 187
            ..|.|               ..:.:.|....|||   ....|  ::::.::    ||:.|.:..|
Mouse   120 TLYENAKLLSDNTDEAKDFQKAMIVFQSEFKCCGLENGAADWGNNFVEAKE----SCQCTGTDCA 180

  Fly   188 FFNG-------CVDELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVL 228
            .:.|       |:..:...||.....::.:|..|.::.::..|.|.||
Mouse   181 TYQGSSVYPKTCLSLIKDLFEKNIIIVIGIAFGLAVIEILGLVFSMVL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 54/243 (22%)
tetraspanin_LEL 116..204 CDD:239401 19/114 (17%)
Tspan8NP_001162150.1 Tetraspannin 8..228 CDD:366035 51/240 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1205716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.