| Sequence 1: | NP_525037.1 | Gene: | Tsp2A / 31080 | FlyBaseID: | FBgn0024361 | Length: | 244 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_510445.1 | Gene: | tsp-8 / 181567 | WormBaseID: | WBGene00006634 | Length: | 282 | Species: | Caenorhabditis elegans |
| Alignment Length: | 52 | Identity: | 15/52 - (28%) |
|---|---|---|---|
| Similarity: | 27/52 - (51%) | Gaps: | 12/52 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 LIIIITNLLIALYFLSACRKG--VTETGFVAPTVLQIREKLEIDENFPIVFY 58 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tsp2A | NP_525037.1 | Tetraspanin | 19..230 | CDD:459767 | 11/42 (26%) |
| tsp-8 | NP_510445.1 | Tetraspanin | 8..>151 | CDD:459767 | |
| tetraspanin_LEL | 108..243 | CDD:239401 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||