DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and tsp-8

DIOPT Version :10

Sequence 1:NP_525037.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_510445.1 Gene:tsp-8 / 181567 WormBaseID:WBGene00006634 Length:282 Species:Caenorhabditis elegans


Alignment Length:52 Identity:15/52 - (28%)
Similarity:27/52 - (51%) Gaps:12/52 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LIIIITNLLIALYFLSACRKG--VTETGFVAPTVLQIREKLEIDENFPIVFY 58
            |:..|.:||:..|       |  |.:|.::   |.::|:|.:..|:|.:.||
 Worm   416 LLSDIDSLLVDPY-------GDYVIQTAWI---VSEVRDKHDDSESFYVDFY 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_525037.1 Tetraspanin 19..230 CDD:459767 11/42 (26%)
tsp-8NP_510445.1 Tetraspanin 8..>151 CDD:459767
tetraspanin_LEL 108..243 CDD:239401
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.