DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tspan8

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_598210.1 Gene:Tspan8 / 171048 RGDID:621783 Length:235 Species:Rattus norvegicus


Alignment Length:244 Identity:61/244 - (25%)
Similarity:102/244 - (41%) Gaps:53/244 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GCVKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRIL----EAQSFYIGVYVLIGISIVMM 77
            ||:||::|.||.:.|:..|.:..|.:|||..   .|...|:    ...:.:|.|.:||.:..::|
  Rat     6 GCLKYSMFFFNFLFWVCGTLILGLAIWLRVS---KDGKEIITSGDNGTNPFIAVNILIAVGSIIM 67

  Fly    78 AVSFLGCLSALMEN-TLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLRGFVATS 141
            .:.||||..|:.|: .:.|..|:|..:...:.:.||    :..:|..|....:||.:|       
  Rat    68 VLGFLGCCGAVKESRCMLLLFFIGLLLILLLQVAAG----ILGATFKSESSRILNETL------- 121

  Fly   142 EYTYSNYVL-------------TMI--QENIGCCG---ATGPW--DYLDLRQPLPSSCRDTVSGN 186
               |.|..|             .||  |....|||   ....|  ::.|.::    ||:.|.|..
  Rat   122 ---YENAKLLSETSNEAKEVQKAMIAFQSEFKCCGLRFGAADWGKNFPDAKE----SCQCTGSDC 179

  Fly   187 AFFNG-------CVDELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVL 228
            ..:||       |:..:....|.....::.:|..|.::.::..|.|.||
  Rat   180 ESYNGENVYRTTCLSLIKELVEKNIIIVIGIAFGLAVIEILGLVFSMVL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 60/243 (25%)
tetraspanin_LEL 116..204 CDD:239401 24/114 (21%)
Tspan8NP_598210.1 Tetraspannin 8..228 CDD:395265 57/240 (24%)
TM4SF3_like_LEL 106..204 CDD:239407 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1205716at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.