DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and TSPAN19

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001094387.1 Gene:TSPAN19 / 144448 HGNCID:31886 Length:248 Species:Homo sapiens


Alignment Length:240 Identity:46/240 - (19%)
Similarity:85/240 - (35%) Gaps:67/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VKYTLFCFNIV--AWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGV-----------YVLI 70
            :||.|   |::  |:::...||.         ||..|| :|:..:|....           .:||
Human    10 IKYFL---NLINGAFLVLGLLFM---------GFGAWL-LLDRNNFLTAFDENNHFIVPISQILI 61

  Fly    71 GISIVMMAVSFLGCLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQFSTINSSLQPLLNVSLR 135
            |:....:....||.:....|....|.|:.....:.|...|..||.::   |....:|.|.:..: 
Human    62 GMGSSTVLFCLLGYIGIHNEIRWLLIVYAVLITWTFAVQVVLSAFII---TKKEEVQQLWHDKI- 122

  Fly   136 GFVATSEYTYSNY-------------VLTMIQENIGCCGATGPWDYLDLRQ-----PLPSSCR-- 180
                  ::..|.|             :|..:|:.:.|||.....|::..:.     .:|.||.  
Human   123 ------DFVISEYGSKDKPEDITKWTILNALQKTLQCCGQHNYTDWIKNKNKENSGQVPCSCTKS 181

  Fly   181 -------DTVSGNAFFNGCVDELT-WFFEGKTGWIVALAMTLGLL 217
                   |......:..||.:::: |:   ....:..:.:..|||
Human   182 TLRKWFCDEPLNATYLEGCENKISAWY---NVNVLTLIGINFGLL 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 46/240 (19%)
tetraspanin_LEL 116..204 CDD:239401 18/115 (16%)
TSPAN19NP_001094387.1 Tetraspannin 9..240 CDD:278750 46/240 (19%)
CD37_CD82_like_LEL 107..212 CDD:239413 18/117 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.