DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and tsp-6

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001294830.1 Gene:tsp-6 / 13219712 WormBaseID:WBGene00006632 Length:237 Species:Caenorhabditis elegans


Alignment Length:240 Identity:52/240 - (21%)
Similarity:103/240 - (42%) Gaps:29/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CVKYTLFCFNIVAWMISTALFALTVWLRAEPG---------------FNDWLRILEAQSFYIGVY 67
            ||||..:..|.:.:::...:..|::|:..:..               ....:.|.:..||   :|
 Worm     9 CVKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQLNSF---LY 70

  Fly    68 VLIGISIVMMAVSFLGCLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQF---STINSSLQPL 129
            |.|.|...::.:.|.||..:..|:..|:.::....:..|:..|.  |::|.|   :.:....|.:
 Worm    71 VAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVV--AIVLYFVNKTNLQQGFQTI 133

  Fly   130 LNVSLRGFVATSEYTYSNYVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVD 194
            ....|.....|.:..:.  ||..||.::.||||:|..||:.. ...|:||:......|   ||..
 Worm   134 WRDELVSKYNTQQQIHQ--VLDQIQSSLQCCGASGCSDYIPY-GAFPTSCQCATIQQA---GCAT 192

  Fly   195 ELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQAVKKEEEQA 239
            .:...||....::..:.:.:..:.::..:.|.:::.|||::..||
 Worm   193 VIWNSFESSLIYVAFVGIIILFVELLAMIFSCIIIGAVKEKRSQA 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 47/231 (20%)
tetraspanin_LEL 116..204 CDD:239401 24/90 (27%)
tsp-6NP_001294830.1 Tetraspannin 9..227 CDD:278750 47/228 (21%)
tetraspanin_LEL 120..202 CDD:239401 23/87 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X522
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.