DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Cd53

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_031677.1 Gene:Cd53 / 12508 MGIID:88341 Length:219 Species:Mus musculus


Alignment Length:220 Identity:53/220 - (24%)
Similarity:94/220 - (42%) Gaps:34/220 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFLG 83
            :||.||.||::.|:....:....::...:..:....|.|   .|.....:|:.:..::|.|:|||
Mouse     9 LKYVLFIFNLLFWVCGCCILGFGIYFLVQNTYGVLFRNL---PFLTLGNILVIVGSIIMVVAFLG 70

  Fly    84 CLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQF-STINSSLQPLLNVSLRGFVATSEYTYSN 147
            |:.::.||...|..|....:...:|.|..:.:|..: ..:|:.:...||.|::      .|...|
Mouse    71 CMGSIKENKCLLMSFFVLLLIILLAEVTIAILLFVYEQKLNTLVAEGLNDSIQ------HYHSDN 129

  Fly   148 YVL---TMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSGNAFFNGCVDEL-TWFFEGKTGWIV 208
            ..:   ..||..:.|||..|..|:..  .| ||||    ...|...||.::. :||...      
Mouse   130 STMKAWDFIQTQLQCCGVNGSSDWTS--GP-PSSC----PSGADVQGCYNKAKSWFHSN------ 181

  Fly   209 ALAMTLGLLNV-ICAV----MSFVL 228
              .:.:|::.: :|.:    |||.|
Mouse   182 --FLYIGIITICVCVIQVLGMSFAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 53/220 (24%)
tetraspanin_LEL 116..204 CDD:239401 24/92 (26%)
Cd53NP_031677.1 Tetraspannin 9..210 CDD:278750 53/220 (24%)
CD53_like_LEL 104..186 CDD:239417 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.