DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and Tsp68C

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:189 Identity:41/189 - (21%)
Similarity:54/189 - (28%) Gaps:96/189 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CLSALMENTLALFVFVGTQVFGFIAIVAG------------SAVLLQFSTINSSL-QPL-----L 130
            |.:......|..|:|:   :.|.:.:|:|            |.:|...|...||| |||     |
  Fly     4 CFNYKFVLNLCNFLFL---ICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIAL 65

  Fly   131 NVSLRGFVATSE----------YTY---------------------------------------- 145
            .|::.|||||..          :||                                        
  Fly    66 GVAIAGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQM 130

  Fly   146 -----SNY----------VLTMIQENIGCCGA-------TGPW---DYLDLRQPLPSSC 179
                 |||          .|.:.|...||||.       |..|   .|.....|:|.||
  Fly   131 VRSLQSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSC 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 41/189 (22%)
tetraspanin_LEL 116..204 CDD:239401 33/145 (23%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 40/185 (22%)
tetraspanin_LEL 117..241 CDD:239401 16/73 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.