DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp2A and TSPAN3

DIOPT Version :9

Sequence 1:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_005715.1 Gene:TSPAN3 / 10099 HGNCID:17752 Length:253 Species:Homo sapiens


Alignment Length:236 Identity:48/236 - (20%)
Similarity:94/236 - (39%) Gaps:47/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFLGC 84
            |..|...|::.|..:..|..:..::...  ::|:....|.....|...|:|.:..::..:..:||
Human    10 KTVLVFLNLIFWGAAGILCYVGAYVFIT--YDDYDHFFEDVYTLIPAVVIIAVGALLFIIGLIGC 72

  Fly    85 LSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQF-------STINSSLQPLLNVSLRGFVATSE 142
            .:.:.|:...|..||...:..|:..|.  .|:|.:       :.::.|:|.:..           
Human    73 CATIRESRCGLATFVIILLLVFVTEVV--VVVLGYVYRAKVENEVDRSIQKVYK----------- 124

  Fly   143 YTY-------SNYVLTMIQENIGCCGA--TGPWDYLD-----LRQPLP-SSCRDTVSGNAFFNGC 192
             ||       ::..:..:|..:.|||.  ...|:..|     ..|.:| |.||:|.|.   .||.
Human   125 -TYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASN---CNGS 185

  Fly   193 V---DELTWFFEGKTGWIVALAMTLGLLNVICAVMSFVLVQ 230
            :   .:|  :.||....:|.....: :::||.|.::|..:|
Human   186 LAHPSDL--YAEGCEALVVKKLQEI-MMHVIWAALAFAAIQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 48/236 (20%)
tetraspanin_LEL 116..204 CDD:239401 23/112 (21%)
TSPAN3NP_005715.1 Tetraspannin 9..232 CDD:395265 48/236 (20%)
TM4SF8_like_LEL 104..210 CDD:239416 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.