DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and ARD1

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_011877.1 Gene:ARD1 / 856404 SGDID:S000001055 Length:238 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:46/188 - (24%)
Similarity:71/188 - (37%) Gaps:60/188 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 MHDIMRLIQA---ELSEPYSIYTYRYFIYNWPKLCFLAS--------HDNQ-------------- 279
            ::||:.:..|   .|.|.|.:..|.|.|.:||:..|:|:        .|.|              
Yeast    10 INDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQDENDKLELTLDGTN 74

  Fly   280 -----------------YVGAIVCKL----DMHMNVRRGYIAMLAVRKEYRKLKIGTTLVTKAIE 323
                             .||.::.|:    |.......|:|..|:|.:.||::.|...|:.:|:.
Yeast    75 DGRTIKLDPTYLAPGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSVMRTYRRMGIAENLMRQALF 139

  Fly   324 AML-ADNADEVVLETEMRNQPALRLYENLGFVRDKRLFR-------YYLNGVDALRLK 373
            |:. ...|:.|.|.....|:.||.||      ||...|.       ||.:|.||..:|
Yeast   140 ALREVHQAEYVSLHVRQSNRAALHLY------RDTLAFEVLSIEKSYYQDGEDAYAMK 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 44/181 (24%)
Acetyltransf_1 276..354 CDD:278980 24/113 (21%)
ARD1NP_011877.1 RimI 1..192 CDD:223532 46/188 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.