DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and nat15

DIOPT Version :9

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001076341.1 Gene:nat15 / 570640 ZFINID:ZDB-GENE-041111-143 Length:242 Species:Danio rerio


Alignment Length:107 Identity:30/107 - (28%)
Similarity:42/107 - (39%) Gaps:20/107 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 VGAIVCKLDMHMNVRR----------------GYIAMLAVRKEYRKLKIGTTL---VTKAIEAML 326
            ||.||.::.....|.:                .||..|.|.||:||..||:.|   :.:.|....
Zfish    64 VGMIVAEIKSRTKVHKEDGDILASSFPVDTQVAYILSLGVVKEFRKHGIGSLLLDSLKEHISTTA 128

  Fly   327 ADNADEVVLETEMRNQPALRLYENLGFVRDKRLFRYY-LNGV 367
            .|:...:.|.....|..|:..|||..|.:...|..|| :.||
Zfish   129 QDHCKAIYLHVLTTNNTAIHFYENRDFKQHHYLPYYYSIRGV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 rimI 242..370 CDD:273701 30/107 (28%)
Acetyltransf_1 276..354 CDD:278980 24/91 (26%)
nat15NP_001076341.1 RimI 20..166 CDD:223532 27/101 (27%)
Acetyltransf_1 79..156 CDD:278980 19/76 (25%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 101..103 1/1 (100%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 109..114 2/4 (50%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 150..153 2/2 (100%)
Required for homodimerization. /evidence=ECO:0000250|UniProtKB:Q9H7X0 162..173 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.