DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30A and Naa10

DIOPT Version :10

Sequence 1:NP_726727.1 Gene:Naa30A / 31079 FlyBaseID:FBgn0024362 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_063923.1 Gene:Naa10 / 56292 MGIID:1915255 Length:235 Species:Mus musculus


Alignment Length:139 Identity:45/139 - (32%)
Similarity:74/139 - (53%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 DIMRLIQAE---LSEPYSIYTYRYFIYNWPKLCFLASHDN-QYVGAIVCKLDMHM-NVRRGYIAM 301
            |:|.:....   |.|.|.:..|.|...:||:|.::|..:| :.||.::.|::... :|..|:|..
Mouse    10 DLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITS 74

  Fly   302 LAVRKEYRKLKIGTTLVTKAIEAMLAD-NADEVVLETEMRNQPALRLYEN-LGFVRDKRLFRYYL 364
            |||::.:|:|.:...|:.:|..||:.: ||..|.|.....|:.||.||.| |.|...:...:||.
Mouse    75 LAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYA 139

  Fly   365 NGVDALRLK 373
            :|.||..:|
Mouse   140 DGEDAYAMK 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30ANP_726727.1 Acetyltransf_1 240..353 CDD:395465 38/117 (32%)
Naa10NP_063923.1 Interaction with NAA15. /evidence=ECO:0000250 1..58 14/47 (30%)
RimI 54..152 CDD:440224 32/95 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..235
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.